Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5803..6328 Replicon plasmid p53022-165.2
Accession NZ_CP098339
Organism Klebsiella pneumoniae strain 53022_J1

Toxin (Protein)


Gene name ccdB Uniprot ID W8UQV6
Locus tag NB666_RS26965 Protein ID WP_001568026.1
Coordinates 5803..6108 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NB666_RS26970 Protein ID WP_001568025.1
Coordinates 6110..6328 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB666_RS26935 (NB666_26935) 1519..2145 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NB666_RS26940 (NB666_26940) 2142..2444 + 303 WP_004197636.1 hypothetical protein -
NB666_RS26945 (NB666_26945) 2884..3678 - 795 WP_004197635.1 site-specific integrase -
NB666_RS26950 (NB666_26950) 3876..4892 - 1017 WP_020315256.1 hypothetical protein -
NB666_RS26955 (NB666_26955) 4889..5212 - 324 WP_022644730.1 hypothetical protein -
NB666_RS26960 (NB666_26960) 5239..5634 - 396 WP_017899885.1 hypothetical protein -
NB666_RS26965 (NB666_26965) 5803..6108 - 306 WP_001568026.1 type II toxin-antitoxin system toxin CcdB Toxin
NB666_RS26970 (NB666_26970) 6110..6328 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NB666_RS26975 (NB666_26975) 6534..6957 - 424 Protein_9 hypothetical protein -
NB666_RS26980 (NB666_26980) 6914..7144 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NB666_RS26985 (NB666_26985) 7141..7557 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NB666_RS26990 (NB666_26990) 7631..7849 + 219 Protein_12 AAA family ATPase -
NB666_RS26995 (NB666_26995) 7914..8618 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NB666_RS27000 (NB666_27000) 8671..9438 - 768 Protein_14 class 1 integron integrase IntI1 -
NB666_RS27005 (NB666_27005) 9594..10067 + 474 WP_004201280.1 trimethoprim-resistant dihydrofolate reductase DfrA14 -
NB666_RS27010 (NB666_27010) 10288..10440 + 153 Protein_16 plasmid mobilization relaxosome protein MobC -
NB666_RS27015 (NB666_27015) 10514..10579 + 66 Protein_17 EAL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaKPC-3 / blaSHV-182 - 1..165212 165212


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11645.32 Da        Isoelectric Point: 5.6919

>T247464 WP_001568026.1 NZ_CP098339:c6108-5803 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT247464 WP_001568025.1 NZ_CP098339:c6328-6110 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A514EZN1

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References