Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4201425..4202044 Replicon chromosome
Accession NZ_CP098338
Organism Klebsiella pneumoniae strain 53022_J1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NB666_RS20775 Protein ID WP_002892050.1
Coordinates 4201826..4202044 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NB666_RS20770 Protein ID WP_002892066.1
Coordinates 4201425..4201799 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB666_RS20760 (NB666_20760) 4196577..4197770 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NB666_RS20765 (NB666_20765) 4197793..4200939 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NB666_RS20770 (NB666_20770) 4201425..4201799 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NB666_RS20775 (NB666_20775) 4201826..4202044 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NB666_RS20780 (NB666_20780) 4202203..4202769 + 567 WP_002892030.1 maltose O-acetyltransferase -
NB666_RS20785 (NB666_20785) 4202741..4202881 - 141 WP_004147370.1 hypothetical protein -
NB666_RS20790 (NB666_20790) 4202902..4203372 + 471 WP_002892026.1 YlaC family protein -
NB666_RS20795 (NB666_20795) 4203347..4204798 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NB666_RS20800 (NB666_20800) 4204899..4205597 + 699 WP_002892021.1 GNAT family protein -
NB666_RS20805 (NB666_20805) 4205594..4205734 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NB666_RS20810 (NB666_20810) 4205734..4205997 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T247459 WP_002892050.1 NZ_CP098338:4201826-4202044 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT247459 WP_002892066.1 NZ_CP098338:4201425-4201799 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References