Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4189798..4190417 Replicon chromosome
Accession NZ_CP098335
Organism Klebsiella pneumoniae strain 53023_J2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NB665_RS20730 Protein ID WP_002892050.1
Coordinates 4190199..4190417 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NB665_RS20725 Protein ID WP_002892066.1
Coordinates 4189798..4190172 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB665_RS20715 (NB665_20715) 4184950..4186143 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NB665_RS20720 (NB665_20720) 4186166..4189312 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NB665_RS20725 (NB665_20725) 4189798..4190172 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NB665_RS20730 (NB665_20730) 4190199..4190417 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NB665_RS20735 (NB665_20735) 4190576..4191142 + 567 WP_002892030.1 maltose O-acetyltransferase -
NB665_RS20740 (NB665_20740) 4191114..4191254 - 141 WP_004147370.1 hypothetical protein -
NB665_RS20745 (NB665_20745) 4191275..4191745 + 471 WP_002892026.1 YlaC family protein -
NB665_RS20750 (NB665_20750) 4191720..4193171 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NB665_RS20755 (NB665_20755) 4193272..4193970 + 699 WP_002892021.1 GNAT family protein -
NB665_RS20760 (NB665_20760) 4193967..4194107 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NB665_RS20765 (NB665_20765) 4194107..4194370 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T247443 WP_002892050.1 NZ_CP098335:4190199-4190417 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT247443 WP_002892066.1 NZ_CP098335:4189798-4190172 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References