Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4855124..4855790 | Replicon | chromosome |
Accession | NZ_CP098330 | ||
Organism | Citrobacter freundii strain 59174 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0D7LIM5 |
Locus tag | NB664_RS23880 | Protein ID | WP_044702260.1 |
Coordinates | 4855431..4855790 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | A0A0D7LIR0 |
Locus tag | NB664_RS23875 | Protein ID | WP_003844682.1 |
Coordinates | 4855124..4855441 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB664_RS23845 (4850791) | 4850791..4851615 | + | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
NB664_RS23850 (4851684) | 4851684..4852907 | + | 1224 | WP_044702265.1 | L-sorbose 1-phosphate reductase | - |
NB664_RS23855 (4852909) | 4852909..4853721 | + | 813 | WP_044702264.1 | shikimate 5-dehydrogenase | - |
NB664_RS23860 (4853773) | 4853773..4854129 | - | 357 | WP_032948294.1 | hypothetical protein | - |
NB664_RS23865 (4854271) | 4854271..4854432 | + | 162 | WP_003841416.1 | phage protein | - |
NB664_RS23870 (4854836) | 4854836..4855114 | + | 279 | WP_044702262.1 | putative addiction module antidote protein | - |
NB664_RS23875 (4855124) | 4855124..4855441 | - | 318 | WP_003844682.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NB664_RS23880 (4855431) | 4855431..4855790 | - | 360 | WP_044702260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NB664_RS23885 (4856004) | 4856004..4856693 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
NB664_RS23890 (4856759) | 4856759..4858390 | - | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13437.49 Da Isoelectric Point: 10.2555
>T247430 WP_044702260.1 NZ_CP098330:c4855790-4855431 [Citrobacter freundii]
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LIM5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LIR0 |