Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4598992..4599508 | Replicon | chromosome |
Accession | NZ_CP098330 | ||
Organism | Citrobacter freundii strain 59174 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NB664_RS22660 | Protein ID | WP_044699148.1 |
Coordinates | 4598992..4599276 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | NB664_RS22665 | Protein ID | WP_003839576.1 |
Coordinates | 4599266..4599508 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB664_RS22645 (4595317) | 4595317..4595901 | + | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
NB664_RS22650 (4596279) | 4596279..4598417 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NB664_RS22655 (4598524) | 4598524..4598988 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NB664_RS22660 (4598992) | 4598992..4599276 | - | 285 | WP_044699148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NB664_RS22665 (4599266) | 4599266..4599508 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NB664_RS22670 (4599586) | 4599586..4601499 | - | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
NB664_RS22675 (4601521) | 4601521..4602261 | - | 741 | WP_044699149.1 | KDGP aldolase family protein | - |
NB664_RS22680 (4602258) | 4602258..4603376 | - | 1119 | WP_044699152.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NB664_RS22685 (4603360) | 4603360..4604493 | - | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10865.69 Da Isoelectric Point: 10.1988
>T247429 WP_044699148.1 NZ_CP098330:c4599276-4598992 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|