Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 4118123..4118802 | Replicon | chromosome |
| Accession | NZ_CP098330 | ||
| Organism | Citrobacter freundii strain 59174 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
| Locus tag | NB664_RS20335 | Protein ID | WP_003031349.1 |
| Coordinates | 4118461..4118802 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
| Locus tag | NB664_RS20330 | Protein ID | WP_003031347.1 |
| Coordinates | 4118123..4118440 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB664_RS20305 (4114216) | 4114216..4116213 | - | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
| NB664_RS20310 (4116761) | 4116761..4116908 | + | 148 | Protein_3990 | hypothetical protein | - |
| NB664_RS20315 (4116922) | 4116922..4117383 | + | 462 | WP_003031344.1 | antirestriction protein | - |
| NB664_RS20320 (4117399) | 4117399..4117875 | + | 477 | WP_003031345.1 | RadC family protein | - |
| NB664_RS20325 (4117884) | 4117884..4118105 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
| NB664_RS20330 (4118123) | 4118123..4118440 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NB664_RS20335 (4118461) | 4118461..4118802 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| NB664_RS20340 (4119392) | 4119392..4119994 | - | 603 | WP_224770543.1 | tail fiber assembly protein | - |
| NB664_RS20345 (4119996) | 4119996..4121243 | - | 1248 | WP_250791465.1 | hypothetical protein | - |
| NB664_RS20350 (4121447) | 4121447..4122127 | - | 681 | WP_121927014.1 | DUF2612 domain-containing protein | - |
| NB664_RS20355 (4122124) | 4122124..4123323 | - | 1200 | WP_121927013.1 | baseplate J/gp47 family protein | - |
| NB664_RS20360 (4123324) | 4123324..4123677 | - | 354 | WP_016239889.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4116922..4161317 | 44395 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T247428 WP_003031349.1 NZ_CP098330:4118461-4118802 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JLK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JLJ2 |