Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3807122..3807742 | Replicon | chromosome |
Accession | NZ_CP098330 | ||
Organism | Citrobacter freundii strain 59174 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NB664_RS18695 | Protein ID | WP_002892050.1 |
Coordinates | 3807524..3807742 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NB664_RS18690 | Protein ID | WP_003021733.1 |
Coordinates | 3807122..3807496 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB664_RS18680 (3802269) | 3802269..3803462 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NB664_RS18685 (3803485) | 3803485..3806634 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
NB664_RS18690 (3807122) | 3807122..3807496 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NB664_RS18695 (3807524) | 3807524..3807742 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NB664_RS18700 (3807876) | 3807876..3808907 | - | 1032 | WP_001395480.1 | IS630-like element ISEc33 family transposase | - |
NB664_RS18705 (3809204) | 3809204..3809755 | + | 552 | WP_044699372.1 | maltose O-acetyltransferase | - |
NB664_RS18710 (3809872) | 3809872..3810342 | + | 471 | WP_003021724.1 | YlaC family protein | - |
NB664_RS18715 (3810421) | 3810421..3810561 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NB664_RS18720 (3810563) | 3810563..3810823 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
NB664_RS18725 (3811012) | 3811012..3812565 | + | 1554 | WP_044699371.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3807876..3808907 | 1031 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247427 WP_002892050.1 NZ_CP098330:3807524-3807742 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT247427 WP_003021733.1 NZ_CP098330:3807122-3807496 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |