Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 284441..285072 | Replicon | chromosome |
Accession | NZ_CP098330 | ||
Organism | Citrobacter freundii strain 59174 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0J1MPQ6 |
Locus tag | NB664_RS01325 | Protein ID | WP_003837806.1 |
Coordinates | 284441..284716 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0J1MMS0 |
Locus tag | NB664_RS01330 | Protein ID | WP_003837808.1 |
Coordinates | 284713..285072 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB664_RS01315 (280492) | 280492..283239 | + | 2748 | WP_044701369.1 | ribosome-associated ATPase/putative transporter RbbA | - |
NB664_RS01320 (283239) | 283239..284363 | + | 1125 | WP_003837801.1 | ABC transporter permease | - |
NB664_RS01325 (284441) | 284441..284716 | + | 276 | WP_003837806.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NB664_RS01330 (284713) | 284713..285072 | + | 360 | WP_003837808.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NB664_RS01335 (285183) | 285183..285584 | - | 402 | WP_003023387.1 | nickel-responsive transcriptional regulator NikR | - |
NB664_RS01340 (285634) | 285634..286212 | - | 579 | WP_003837810.1 | 4'-phosphopantetheinyl transferase AcpT | - |
NB664_RS01345 (286275) | 286275..287324 | - | 1050 | WP_003023393.1 | AI-2E family transporter | - |
NB664_RS01350 (287458) | 287458..288675 | + | 1218 | WP_003846164.1 | MFS transporter | - |
NB664_RS01355 (288679) | 288679..289236 | - | 558 | WP_003837816.1 | DcrB family lipoprotein | - |
NB664_RS01360 (289309) | 289309..289974 | - | 666 | WP_044701371.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10210.88 Da Isoelectric Point: 10.7228
>T247420 WP_003837806.1 NZ_CP098330:284441-284716 [Citrobacter freundii]
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13198.98 Da Isoelectric Point: 4.5462
>AT247420 WP_003837808.1 NZ_CP098330:284713-285072 [Citrobacter freundii]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MPQ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MMS0 |