Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
| Location | 7958..8559 | Replicon | plasmid p2 |
| Accession | NZ_CP098329 | ||
| Organism | Lactiplantibacillus plantarum strain HOM3204 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | LGV77_RS15580 | Protein ID | WP_063486515.1 |
| Coordinates | 7958..8302 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | Q684P2 |
| Locus tag | LGV77_RS15585 | Protein ID | WP_003643337.1 |
| Coordinates | 8296..8559 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LGV77_RS15565 (LGV77_15485) | 3564..3653 | + | 90 | Protein_3 | IS30 family transposase | - |
| LGV77_RS15570 (LGV77_15490) | 3695..4162 | - | 468 | WP_042253884.1 | DNA starvation/stationary phase protection protein | - |
| LGV77_RS15575 (LGV77_15495) | 5304..7601 | - | 2298 | WP_014271901.1 | DUF1906 domain-containing protein | - |
| LGV77_RS15580 (LGV77_15500) | 7958..8302 | - | 345 | WP_063486515.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LGV77_RS15585 (LGV77_15505) | 8296..8559 | - | 264 | WP_003643337.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| LGV77_RS15590 (LGV77_15510) | 8645..8947 | + | 303 | Protein_8 | site-specific integrase | - |
| LGV77_RS15595 (LGV77_15515) | 9307..10863 | + | 1557 | WP_054736640.1 | reverse transcriptase/maturase family protein | - |
| LGV77_RS15600 (LGV77_15520) | 11333..11686 | + | 354 | WP_021730116.1 | plasmid mobilization relaxosome protein MobC | - |
| LGV77_RS15605 (LGV77_15525) | 11668..12837 | + | 1170 | WP_105450236.1 | relaxase/mobilization nuclease domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..17060 | 17060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13068.91 Da Isoelectric Point: 6.4782
>T247418 WP_063486515.1 NZ_CP098329:c8302-7958 [Lactiplantibacillus plantarum]
MVNQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVNQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|