Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3834443..3835103 | Replicon | chromosome |
| Accession | NZ_CP098325 | ||
| Organism | Leclercia adecarboxylata strain kcgeb_e1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NB069_RS18055 | Protein ID | WP_250585783.1 |
| Coordinates | 3834443..3834856 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NB069_RS18060 | Protein ID | WP_039029834.1 |
| Coordinates | 3834837..3835103 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB069_RS18035 (NB069_18035) | 3830446..3832179 | - | 1734 | WP_250585775.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NB069_RS18040 (NB069_18040) | 3832185..3832898 | - | 714 | WP_250585777.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NB069_RS18045 (NB069_18045) | 3832920..3833816 | - | 897 | WP_250585779.1 | site-specific tyrosine recombinase XerD | - |
| NB069_RS18050 (NB069_18050) | 3833917..3834438 | + | 522 | WP_250585781.1 | flavodoxin FldB | - |
| NB069_RS18055 (NB069_18055) | 3834443..3834856 | - | 414 | WP_250585783.1 | protein YgfX | Toxin |
| NB069_RS18060 (NB069_18060) | 3834837..3835103 | - | 267 | WP_039029834.1 | FAD assembly factor SdhE | Antitoxin |
| NB069_RS18065 (NB069_18065) | 3835407..3836387 | + | 981 | WP_250585786.1 | tRNA-modifying protein YgfZ | - |
| NB069_RS18070 (NB069_18070) | 3836478..3837137 | - | 660 | WP_250585788.1 | hemolysin III family protein | - |
| NB069_RS18075 (NB069_18075) | 3837303..3837614 | - | 312 | WP_250585790.1 | N(4)-acetylcytidine aminohydrolase | - |
| NB069_RS18080 (NB069_18080) | 3837667..3838398 | + | 732 | WP_250589541.1 | MurR/RpiR family transcriptional regulator | - |
| NB069_RS18085 (NB069_18085) | 3838513..3839946 | + | 1434 | WP_250585792.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16193.01 Da Isoelectric Point: 11.1911
>T247417 WP_250585783.1 NZ_CP098325:c3834856-3834443 [Leclercia adecarboxylata]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFILLMPWPLSYTPLWLILLSLVVFDSVRSQRRINARQGEIKLFMDSRLHWLGS
EWEIVGTPWMLNSGMMLRLRKSAGQRCHHLWLAADSMDEGEWRDLRRMISHQPTQGR
VVLWQSDLRVSWRSQWMSLLLHGLVAAFILLMPWPLSYTPLWLILLSLVVFDSVRSQRRINARQGEIKLFMDSRLHWLGS
EWEIVGTPWMLNSGMMLRLRKSAGQRCHHLWLAADSMDEGEWRDLRRMISHQPTQGR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|