Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1039650..1040269 | Replicon | chromosome |
| Accession | NZ_CP098325 | ||
| Organism | Leclercia adecarboxylata strain kcgeb_e1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A345CDT0 |
| Locus tag | NB069_RS04860 | Protein ID | WP_032616864.1 |
| Coordinates | 1039650..1039868 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NB069_RS04865 | Protein ID | WP_250588023.1 |
| Coordinates | 1039877..1040269 (-) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB069_RS04840 (NB069_04840) | 1036596..1036949 | + | 354 | WP_250588017.1 | DUF1428 family protein | - |
| NB069_RS04845 (NB069_04845) | 1036982..1038550 | - | 1569 | WP_250588019.1 | EAL domain-containing protein | - |
| NB069_RS04850 (NB069_04850) | 1038721..1038861 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NB069_RS04855 (NB069_04855) | 1038919..1039383 | - | 465 | WP_250588021.1 | YlaC family protein | - |
| NB069_RS04860 (NB069_04860) | 1039650..1039868 | - | 219 | WP_032616864.1 | HHA domain-containing protein | Toxin |
| NB069_RS04865 (NB069_04865) | 1039877..1040269 | - | 393 | WP_250588023.1 | Hha toxicity modulator TomB | Antitoxin |
| NB069_RS04870 (NB069_04870) | 1040759..1043899 | - | 3141 | WP_250588025.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NB069_RS04875 (NB069_04875) | 1043922..1045115 | - | 1194 | WP_250588027.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1029719..1040269 | 10550 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T247408 WP_032616864.1 NZ_CP098325:c1039868-1039650 [Leclercia adecarboxylata]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTAVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 15123.03 Da Isoelectric Point: 4.8941
>AT247408 WP_250588023.1 NZ_CP098325:c1040269-1039877 [Leclercia adecarboxylata]
MDEYSPKRQDIAQLKFLCESLYHDCLTNLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVTASRANPLASPVKIITNN
MDEYSPKRQDIAQLKFLCESLYHDCLTNLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVTASRANPLASPVKIITNN
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|