Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 448670..449265 | Replicon | chromosome |
| Accession | NZ_CP098325 | ||
| Organism | Leclercia adecarboxylata strain kcgeb_e1 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | NB069_RS02125 | Protein ID | WP_250587354.1 |
| Coordinates | 448915..449265 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | NB069_RS02120 | Protein ID | WP_250587352.1 |
| Coordinates | 448670..448921 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB069_RS02110 (NB069_02110) | 444337..448113 | + | 3777 | WP_250587350.1 | autotransporter assembly complex protein TamB | - |
| NB069_RS02115 (NB069_02115) | 448116..448460 | + | 345 | WP_039028479.1 | gamma-glutamylcyclotransferase | - |
| NB069_RS02120 (NB069_02120) | 448670..448921 | + | 252 | WP_250587352.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NB069_RS02125 (NB069_02125) | 448915..449265 | + | 351 | WP_250587354.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NB069_RS02130 (NB069_02130) | 449371..449898 | - | 528 | WP_250587356.1 | inorganic diphosphatase | - |
| NB069_RS02135 (NB069_02135) | 450208..451164 | + | 957 | WP_032616231.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NB069_RS02140 (NB069_02140) | 451269..452771 | + | 1503 | WP_250587358.1 | sugar ABC transporter ATP-binding protein | - |
| NB069_RS02145 (NB069_02145) | 452782..453807 | + | 1026 | WP_250587360.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12516.50 Da Isoelectric Point: 6.9497
>T247407 WP_250587354.1 NZ_CP098325:448915-449265 [Leclercia adecarboxylata]
MVKARGFERGDIVRVRFSPSSGHEQQGEGRPALVLSVSAFNQLGMVLVAPITQGGNFARYAGFCVPVSCEEGDVQGVILV
NQIRMMDLKARQAIKVAVATDDVVQDALMRLQAIVD
MVKARGFERGDIVRVRFSPSSGHEQQGEGRPALVLSVSAFNQLGMVLVAPITQGGNFARYAGFCVPVSCEEGDVQGVILV
NQIRMMDLKARQAIKVAVATDDVVQDALMRLQAIVD
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|