Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 59337..59999 | Replicon | chromosome |
Accession | NZ_CP098325 | ||
Organism | Leclercia adecarboxylata strain kcgeb_e1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NB069_RS00305 | Protein ID | WP_250586824.1 |
Coordinates | 59601..59999 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NB069_RS00300 | Protein ID | WP_250586822.1 |
Coordinates | 59337..59597 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB069_RS00270 (NB069_00270) | 54357..54671 | - | 315 | WP_039030206.1 | PTS sugar transporter subunit IIB | - |
NB069_RS00275 (NB069_00275) | 54966..55913 | + | 948 | WP_250586812.1 | LacI family DNA-binding transcriptional regulator | - |
NB069_RS00280 (NB069_00280) | 55948..56244 | - | 297 | WP_250586814.1 | YicS family protein | - |
NB069_RS00285 (NB069_00285) | 56566..56985 | + | 420 | WP_250586816.1 | GNAT family N-acetyltransferase | - |
NB069_RS00290 (NB069_00290) | 56982..57641 | - | 660 | WP_250586818.1 | TetR/AcrR family transcriptional regulator | - |
NB069_RS00295 (NB069_00295) | 57720..59225 | + | 1506 | WP_250586820.1 | MDR family MFS transporter | - |
NB069_RS00300 (NB069_00300) | 59337..59597 | + | 261 | WP_250586822.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NB069_RS00305 (NB069_00305) | 59601..59999 | + | 399 | WP_250586824.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NB069_RS00310 (NB069_00310) | 60168..60971 | + | 804 | WP_250586826.1 | lipoprotein NlpA | - |
NB069_RS00315 (NB069_00315) | 61110..61889 | + | 780 | WP_250586828.1 | MBL fold metallo-hydrolase | - |
NB069_RS00320 (NB069_00320) | 61915..62883 | + | 969 | WP_250586830.1 | helix-turn-helix domain-containing protein | - |
NB069_RS00325 (NB069_00325) | 62897..63985 | - | 1089 | WP_250586832.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 6.1255
>T247406 WP_250586824.1 NZ_CP098325:59601-59999 [Leclercia adecarboxylata]
MLHMLDTNIVSHLVRQHPSVVNHYSQIAPEDMCISSVTEAELLYGVAKKQSHALHETISAFLKTITICDWDSDAAAIYGK
LRADMEKRGKVMGDLDQLIAAHALSRGTTIVTNDRAFGMVQELKVEDWTTAA
MLHMLDTNIVSHLVRQHPSVVNHYSQIAPEDMCISSVTEAELLYGVAKKQSHALHETISAFLKTITICDWDSDAAAIYGK
LRADMEKRGKVMGDLDQLIAAHALSRGTTIVTNDRAFGMVQELKVEDWTTAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|