Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/Txe-RelB |
Location | 423829..424336 | Replicon | chromosome |
Accession | NZ_CP098324 | ||
Organism | Rickettsia conorii subsp. raoultii strain BIME |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NBT09_RS02315 | Protein ID | WP_064462994.1 |
Coordinates | 424073..424336 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | H8K421 |
Locus tag | NBT09_RS02310 | Protein ID | WP_014391803.1 |
Coordinates | 423829..424080 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBT09_RS02275 (NBT09_02275) | 418997..420064 | - | 1068 | WP_250720035.1 | alanine racemase | - |
NBT09_RS02280 (NBT09_02280) | 420131..420349 | - | 219 | WP_232218745.1 | palindromic element RPE1 domain-containing protein | - |
NBT09_RS02285 (NBT09_02285) | 420380..420715 | - | 336 | Protein_453 | ribose-phosphate diphosphokinase | - |
NBT09_RS02290 (NBT09_02290) | 420782..421081 | - | 300 | WP_064463000.1 | ribose-phosphate pyrophosphokinase-like domain-containing protein | - |
NBT09_RS02295 (NBT09_02295) | 421306..421905 | - | 600 | WP_064462998.1 | phospholipid-binding protein MlaC | - |
NBT09_RS02300 (NBT09_02300) | 421925..422680 | - | 756 | WP_250720037.1 | VacJ family lipoprotein | - |
NBT09_RS02305 (NBT09_02305) | 422685..423689 | - | 1005 | WP_250720040.1 | methyltransferase domain-containing protein | - |
NBT09_RS02310 (NBT09_02310) | 423829..424080 | + | 252 | WP_014391803.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NBT09_RS02315 (NBT09_02315) | 424073..424336 | + | 264 | WP_064462994.1 | Txe/YoeB family addiction module toxin | Toxin |
NBT09_RS02320 (NBT09_02320) | 424396..425601 | + | 1206 | WP_064462992.1 | pyridoxal phosphate-dependent aminotransferase | - |
NBT09_RS02325 (NBT09_02325) | 425752..426408 | + | 657 | WP_064462990.1 | lysophospholipid acyltransferase family protein | - |
NBT09_RS02330 (NBT09_02330) | 426405..427799 | + | 1395 | WP_064462988.1 | lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase | - |
NBT09_RS02335 (NBT09_02335) | 427820..428161 | - | 342 | WP_250720042.1 | hypothetical protein | - |
NBT09_RS02340 (NBT09_02340) | 428206..428835 | - | 630 | WP_250720045.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10571.43 Da Isoelectric Point: 10.1250
>T247405 WP_064462994.1 NZ_CP098324:424073-424336 [Rickettsia conorii subsp. raoultii]
MIEIEWTLEAAEDLAYWKKYDIKKYERIKLLIKNIQEAPFTGIGKPKPLKHILSGLWSRRINHEHRLIYSVNTKQIIIYN
CRFHYKN
MIEIEWTLEAAEDLAYWKKYDIKKYERIKLLIKNIQEAPFTGIGKPKPLKHILSGLWSRRINHEHRLIYSVNTKQIIIYN
CRFHYKN
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|