Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 252380..253016 | Replicon | chromosome |
Accession | NZ_CP098323 | ||
Organism | Cytobacillus firmus strain PheN7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W7KPR3 |
Locus tag | NAF01_RS01360 | Protein ID | WP_009336311.1 |
Coordinates | 252666..253016 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | W7L1R3 |
Locus tag | NAF01_RS01355 | Protein ID | WP_035331931.1 |
Coordinates | 252380..252661 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAF01_RS01335 (NAF01_01335) | 247951..248676 | - | 726 | WP_250801583.1 | rhomboid family intramembrane serine protease | - |
NAF01_RS01340 (NAF01_01340) | 248832..249185 | + | 354 | WP_048008767.1 | holo-ACP synthase | - |
NAF01_RS01345 (NAF01_01345) | 249330..250343 | + | 1014 | WP_197212719.1 | outer membrane lipoprotein carrier protein LolA | - |
NAF01_RS01350 (NAF01_01350) | 250881..252035 | + | 1155 | WP_226620280.1 | alanine racemase | - |
NAF01_RS01355 (NAF01_01355) | 252380..252661 | + | 282 | WP_035331931.1 | YlcI/YnfO family protein | Antitoxin |
NAF01_RS01360 (NAF01_01360) | 252666..253016 | + | 351 | WP_009336311.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NAF01_RS01365 (NAF01_01365) | 253391..254224 | + | 834 | WP_163144748.1 | RsbT co-antagonist protein RsbRA | - |
NAF01_RS01370 (NAF01_01370) | 254221..254583 | + | 363 | WP_009336309.1 | STAS domain-containing protein | - |
NAF01_RS01375 (NAF01_01375) | 254588..254989 | + | 402 | WP_048008772.1 | anti-sigma regulatory factor | - |
NAF01_RS01380 (NAF01_01380) | 255001..256011 | + | 1011 | WP_048008773.1 | PP2C family protein-serine/threonine phosphatase | - |
NAF01_RS01385 (NAF01_01385) | 256072..256404 | + | 333 | WP_035331808.1 | anti-sigma factor antagonist | - |
NAF01_RS01390 (NAF01_01390) | 256401..256874 | + | 474 | WP_009336304.1 | anti-sigma B factor RsbW | - |
NAF01_RS01395 (NAF01_01395) | 256852..257646 | + | 795 | WP_048008774.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13006.03 Da Isoelectric Point: 4.8998
>T247404 WP_009336311.1 NZ_CP098323:252666-253016 [Cytobacillus firmus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A169FD46 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7L1R3 |