Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 55913..56555 | Replicon | chromosome |
Accession | NZ_CP098322 | ||
Organism | Burkholderia gladioli strain BK04 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | F2LQ48 |
Locus tag | NAL90_RS18915 | Protein ID | WP_013690721.1 |
Coordinates | 55913..56335 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A808W4F3 |
Locus tag | NAL90_RS18920 | Protein ID | WP_036033948.1 |
Coordinates | 56322..56555 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL90_RS18895 (NAL90_18890) | 51713..53086 | + | 1374 | WP_250805264.1 | L-fucose:H+ symporter permease | - |
NAL90_RS18900 (NAL90_18895) | 53089..54171 | + | 1083 | WP_250805266.1 | aldose 1-epimerase family protein | - |
NAL90_RS18905 (NAL90_18900) | 54191..54961 | - | 771 | WP_103692576.1 | DNA-binding transcriptional repressor DeoR | - |
NAL90_RS18910 (NAL90_18905) | 55111..55791 | + | 681 | WP_250805269.1 | deoxyribose-phosphate aldolase | - |
NAL90_RS18915 (NAL90_18910) | 55913..56335 | - | 423 | WP_013690721.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NAL90_RS18920 (NAL90_18915) | 56322..56555 | - | 234 | WP_036033948.1 | DNA-binding protein | Antitoxin |
NAL90_RS18925 (NAL90_18920) | 56871..57860 | - | 990 | WP_105850350.1 | LysR substrate-binding domain-containing protein | - |
NAL90_RS18930 (NAL90_18925) | 58479..60212 | + | 1734 | WP_223996944.1 | AMP-binding protein | - |
NAL90_RS18935 (NAL90_18930) | 60337..60585 | + | 249 | WP_013690725.1 | acyl carrier protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15649.91 Da Isoelectric Point: 8.5438
>T247400 WP_013690721.1 NZ_CP098322:c56335-55913 [Burkholderia gladioli]
MYLIDTNVVSEVRKRDRADKGVMAFFRQAARDDAGLYLSVVTVGELRRGVEIIRHRGDESQATRLANWLDGVLREFAANI
LVVDKEIGQMWGYLRVPRSEHSLDKVIAATALIHDLTVVTRNVDDFAGTGARVLNPFKGP
MYLIDTNVVSEVRKRDRADKGVMAFFRQAARDDAGLYLSVVTVGELRRGVEIIRHRGDESQATRLANWLDGVLREFAANI
LVVDKEIGQMWGYLRVPRSEHSLDKVIAATALIHDLTVVTRNVDDFAGTGARVLNPFKGP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A833Q1H0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A808W4F3 |