Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2268461..2268990 Replicon chromosome
Accession NZ_CP098255
Organism Staphylococcus aureus strain N4

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6DV13
Locus tag NB630_RS10910 Protein ID WP_001103929.1
Coordinates 2268673..2268990 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag NB630_RS10905 Protein ID WP_001058486.1
Coordinates 2268461..2268670 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB630_RS10875 (NB630_10875) 2265136..2266308 - 1173 WP_000024832.1 tyrosine-type recombinase/integrase -
NB630_RS10880 (NB630_10880) 2266321..2266983 - 663 WP_001070979.1 helix-turn-helix transcriptional regulator -
NB630_RS10885 (NB630_10885) 2267137..2267349 + 213 WP_000448765.1 helix-turn-helix transcriptional regulator -
NB630_RS10890 (NB630_10890) 2267353..2267994 + 642 WP_000595329.1 phage repressor protein -
NB630_RS10895 (NB630_10895) 2268008..2268325 + 318 WP_000481972.1 helix-turn-helix domain-containing protein -
NB630_RS10900 (NB630_10900) 2268322..2268468 + 147 WP_000833313.1 hypothetical protein -
NB630_RS10905 (NB630_10905) 2268461..2268670 + 210 WP_001058486.1 hypothetical protein Antitoxin
NB630_RS10910 (NB630_10910) 2268673..2268990 + 318 WP_001103929.1 DUF1474 family protein Toxin
NB630_RS10915 (NB630_10915) 2269054..2269923 + 870 WP_001002839.1 primase alpha helix C-terminal domain-containing protein -
NB630_RS10920 (NB630_10920) 2269940..2271409 + 1470 WP_001834090.1 virulence-associated E family protein -
NB630_RS10925 (NB630_10925) 2271706..2272068 + 363 WP_001039171.1 hypothetical protein -
NB630_RS10930 (NB630_10930) 2272070..2272354 + 285 WP_000998182.1 hypothetical protein -
NB630_RS10935 (NB630_10935) 2272351..2272992 + 642 WP_038413070.1 pathogenicity island protein -
NB630_RS10940 (NB630_10940) 2273339..2273680 + 342 WP_001161492.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - groEL 2263091..2287467 24376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12666.19 Da        Isoelectric Point: 4.5462

>T247383 WP_001103929.1 NZ_CP098255:2268673-2268990 [Staphylococcus aureus]
MNWEIKDLICDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HELEKASSENFDEESDDAQKLKITE

Download         Length: 318 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT247383 WP_001058486.1 NZ_CP098255:2268461-2268670 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6DV13

Antitoxin

Source ID Structure

References