Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2215754..2216283 Replicon chromosome
Accession NZ_CP098255
Organism Staphylococcus aureus strain N4

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag NB630_RS10635 Protein ID WP_000621176.1
Coordinates 2215921..2216283 (+) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag NB630_RS10630 Protein ID WP_000948331.1
Coordinates 2215754..2215924 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB630_RS10600 (NB630_10600) 2210790..2211350 + 561 WP_001092414.1 K(+)-transporting ATPase subunit C -
NB630_RS10605 (NB630_10605) 2211559..2212038 + 480 WP_001287082.1 hypothetical protein -
NB630_RS10610 (NB630_10610) 2212031..2213608 + 1578 WP_001294646.1 PH domain-containing protein -
NB630_RS10615 (NB630_10615) 2213601..2214092 + 492 WP_001286801.1 PH domain-containing protein -
NB630_RS10620 (NB630_10620) 2214096..2214455 + 360 WP_000581197.1 holo-ACP synthase -
NB630_RS10625 (NB630_10625) 2214521..2215669 + 1149 WP_001281140.1 alanine racemase -
NB630_RS10630 (NB630_10630) 2215754..2215924 + 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
NB630_RS10635 (NB630_10635) 2215921..2216283 + 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NB630_RS10640 (NB630_10640) 2216633..2217634 + 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
NB630_RS10645 (NB630_10645) 2217753..2218079 + 327 WP_001052491.1 anti-sigma factor antagonist -
NB630_RS10650 (NB630_10650) 2218081..2218560 + 480 WP_001190825.1 anti-sigma B factor RsbW -
NB630_RS10655 (NB630_10655) 2218535..2219305 + 771 WP_001041107.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T247382 WP_000621176.1 NZ_CP098255:2215921-2216283 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT247382 WP_000948331.1 NZ_CP098255:2215754-2215924 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References