Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2215754..2216283 | Replicon | chromosome |
Accession | NZ_CP098255 | ||
Organism | Staphylococcus aureus strain N4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q6GF05 |
Locus tag | NB630_RS10635 | Protein ID | WP_000621176.1 |
Coordinates | 2215921..2216283 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NB630_RS10630 | Protein ID | WP_000948331.1 |
Coordinates | 2215754..2215924 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB630_RS10600 (NB630_10600) | 2210790..2211350 | + | 561 | WP_001092414.1 | K(+)-transporting ATPase subunit C | - |
NB630_RS10605 (NB630_10605) | 2211559..2212038 | + | 480 | WP_001287082.1 | hypothetical protein | - |
NB630_RS10610 (NB630_10610) | 2212031..2213608 | + | 1578 | WP_001294646.1 | PH domain-containing protein | - |
NB630_RS10615 (NB630_10615) | 2213601..2214092 | + | 492 | WP_001286801.1 | PH domain-containing protein | - |
NB630_RS10620 (NB630_10620) | 2214096..2214455 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
NB630_RS10625 (NB630_10625) | 2214521..2215669 | + | 1149 | WP_001281140.1 | alanine racemase | - |
NB630_RS10630 (NB630_10630) | 2215754..2215924 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NB630_RS10635 (NB630_10635) | 2215921..2216283 | + | 363 | WP_000621176.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NB630_RS10640 (NB630_10640) | 2216633..2217634 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NB630_RS10645 (NB630_10645) | 2217753..2218079 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NB630_RS10650 (NB630_10650) | 2218081..2218560 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
NB630_RS10655 (NB630_10655) | 2218535..2219305 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T247382 WP_000621176.1 NZ_CP098255:2215921-2216283 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A168PYX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0VRZ1 |