Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1175960..1176495 Replicon chromosome
Accession NZ_CP098255
Organism Staphylococcus aureus strain N4

Toxin (Protein)


Gene name TscT Uniprot ID A0A4P7P340
Locus tag NB630_RS05665 Protein ID WP_001103945.1
Coordinates 1175960..1176283 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag NB630_RS05670 Protein ID WP_001058486.1
Coordinates 1176286..1176495 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB630_RS05640 (NB630_05640) 1171115..1171456 - 342 WP_001190612.1 hypothetical protein -
NB630_RS05645 (NB630_05645) 1171973..1172614 - 642 WP_001019780.1 hypothetical protein -
NB630_RS05650 (NB630_05650) 1172611..1172991 - 381 WP_000356936.1 hypothetical protein -
NB630_RS05655 (NB630_05655) 1173303..1175012 - 1710 WP_000447449.1 DUF927 domain-containing protein -
NB630_RS05660 (NB630_05660) 1175026..1175895 - 870 WP_001002723.1 primase alpha helix C-terminal domain-containing protein -
NB630_RS05665 (NB630_05665) 1175960..1176283 - 324 WP_001103945.1 DUF1474 family protein Toxin
NB630_RS05670 (NB630_05670) 1176286..1176495 - 210 WP_001058486.1 hypothetical protein Antitoxin
NB630_RS05675 (NB630_05675) 1176488..1176634 - 147 WP_031824147.1 hypothetical protein -
NB630_RS05680 (NB630_05680) 1176646..1176918 - 273 WP_000091734.1 helix-turn-helix domain-containing protein -
NB630_RS05685 (NB630_05685) 1176919..1177131 - 213 WP_000794656.1 helix-turn-helix transcriptional regulator -
NB630_RS05690 (NB630_05690) 1177275..1177970 + 696 WP_000668212.1 helix-turn-helix domain-containing protein -
NB630_RS05695 (NB630_05695) 1178426..1179640 + 1215 WP_000270132.1 site-specific integrase -
NB630_RS05700 (NB630_05700) 1179641..1180474 + 834 WP_000370312.1 type II toxin-antitoxin system PemK/MazF family toxin -
NB630_RS05705 (NB630_05705) 1180706..1180948 - 243 WP_000897044.1 30S ribosomal protein S18 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1162091..1185563 23472


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12665.26 Da        Isoelectric Point: 4.7124

>T247374 WP_001103945.1 NZ_CP098255:c1176283-1175960 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKNSIKVAE

Download         Length: 324 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT247374 WP_001058486.1 NZ_CP098255:c1176495-1176286 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7P340

Antitoxin

Source ID Structure

References