Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 713802..714279 Replicon chromosome
Accession NZ_CP098255
Organism Staphylococcus aureus strain N4

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NB630_RS03385 Protein ID WP_000052076.1
Coordinates 714091..714279 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NB630_RS03380 Protein ID WP_001059690.1
Coordinates 713802..714062 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB630_RS03345 (NB630_03345) 709193..709909 - 717 WP_000150022.1 type I 3-dehydroquinate dehydratase -
NB630_RS03350 (NB630_03350) 710057..710479 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
NB630_RS03355 (NB630_03355) 710878..711372 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NB630_RS03360 (NB630_03360) 711528..712145 + 618 WP_000255548.1 LysE/ArgO family amino acid transporter -
NB630_RS03365 (NB630_03365) 712218..712799 - 582 WP_001140696.1 histidine phosphatase family protein -
NB630_RS03370 (NB630_03370) 713024..713260 + 237 WP_000368687.1 hypothetical protein -
NB630_RS03375 (NB630_03375) 713257..713460 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NB630_RS03380 (NB630_03380) 713802..714062 + 261 WP_001059690.1 hypothetical protein Antitoxin
NB630_RS03385 (NB630_03385) 714091..714279 + 189 WP_000052076.1 hypothetical protein Toxin
NB630_RS03390 (NB630_03390) 714467..715036 + 570 WP_001106663.1 lipoprotein N-acylation protein LnsA -
NB630_RS03395 (NB630_03395) 715124..715408 + 285 WP_001004401.1 hypothetical protein -
NB630_RS03400 (NB630_03400) 715470..715688 + 219 WP_000005879.1 hypothetical protein -
NB630_RS03405 (NB630_03405) 716185..716385 - 201 WP_001059082.1 cold-shock protein -
NB630_RS03410 (NB630_03410) 716742..717428 - 687 WP_001574556.1 thermonuclease family protein -
NB630_RS03415 (NB630_03415) 717769..718326 - 558 WP_000824491.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T247373 WP_000052076.1 NZ_CP098255:714091-714279 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT247373 WP_001059690.1 NZ_CP098255:713802-714062 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References