Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 2268470..2268999 | Replicon | chromosome |
| Accession | NZ_CP098253 | ||
| Organism | Staphylococcus aureus strain M0 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6DV13 |
| Locus tag | NB629_RS10900 | Protein ID | WP_001103929.1 |
| Coordinates | 2268682..2268999 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | NB629_RS10895 | Protein ID | WP_001058486.1 |
| Coordinates | 2268470..2268679 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB629_RS10865 (NB629_10865) | 2265145..2266317 | - | 1173 | WP_000024832.1 | tyrosine-type recombinase/integrase | - |
| NB629_RS10870 (NB629_10870) | 2266330..2266992 | - | 663 | WP_001070979.1 | helix-turn-helix transcriptional regulator | - |
| NB629_RS10875 (NB629_10875) | 2267146..2267358 | + | 213 | WP_000448765.1 | helix-turn-helix transcriptional regulator | - |
| NB629_RS10880 (NB629_10880) | 2267362..2268003 | + | 642 | WP_000595329.1 | phage repressor protein | - |
| NB629_RS10885 (NB629_10885) | 2268017..2268334 | + | 318 | WP_000481972.1 | helix-turn-helix domain-containing protein | - |
| NB629_RS10890 (NB629_10890) | 2268331..2268477 | + | 147 | WP_000833313.1 | hypothetical protein | - |
| NB629_RS10895 (NB629_10895) | 2268470..2268679 | + | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
| NB629_RS10900 (NB629_10900) | 2268682..2268999 | + | 318 | WP_001103929.1 | DUF1474 family protein | Toxin |
| NB629_RS10905 (NB629_10905) | 2269063..2269932 | + | 870 | WP_001002839.1 | primase alpha helix C-terminal domain-containing protein | - |
| NB629_RS10910 (NB629_10910) | 2269949..2271418 | + | 1470 | WP_001834090.1 | virulence-associated E family protein | - |
| NB629_RS10915 (NB629_10915) | 2271715..2272077 | + | 363 | WP_001039171.1 | hypothetical protein | - |
| NB629_RS10920 (NB629_10920) | 2272079..2272363 | + | 285 | WP_000998182.1 | hypothetical protein | - |
| NB629_RS10925 (NB629_10925) | 2272360..2273001 | + | 642 | WP_038413070.1 | pathogenicity island protein | - |
| NB629_RS10930 (NB629_10930) | 2273348..2273689 | + | 342 | WP_001161492.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL | 2263100..2287476 | 24376 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12666.19 Da Isoelectric Point: 4.5462
>T247370 WP_001103929.1 NZ_CP098253:2268682-2268999 [Staphylococcus aureus]
MNWEIKDLICDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HELEKASSENFDEESDDAQKLKITE
MNWEIKDLICDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HELEKASSENFDEESDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|