Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 713811..714288 Replicon chromosome
Accession NZ_CP098253
Organism Staphylococcus aureus strain M0

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NB629_RS03380 Protein ID WP_000052076.1
Coordinates 714100..714288 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NB629_RS03375 Protein ID WP_001059690.1
Coordinates 713811..714071 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB629_RS03340 (NB629_03340) 709202..709918 - 717 WP_000150022.1 type I 3-dehydroquinate dehydratase -
NB629_RS03345 (NB629_03345) 710066..710488 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
NB629_RS03350 (NB629_03350) 710887..711381 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NB629_RS03355 (NB629_03355) 711537..712154 + 618 WP_000255548.1 LysE/ArgO family amino acid transporter -
NB629_RS03360 (NB629_03360) 712227..712808 - 582 WP_001140696.1 histidine phosphatase family protein -
NB629_RS03365 (NB629_03365) 713033..713269 + 237 WP_000368687.1 hypothetical protein -
NB629_RS03370 (NB629_03370) 713266..713469 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NB629_RS03375 (NB629_03375) 713811..714071 + 261 WP_001059690.1 hypothetical protein Antitoxin
NB629_RS03380 (NB629_03380) 714100..714288 + 189 WP_000052076.1 hypothetical protein Toxin
NB629_RS03385 (NB629_03385) 714476..715045 + 570 WP_001106663.1 lipoprotein N-acylation protein LnsA -
NB629_RS03390 (NB629_03390) 715133..715417 + 285 WP_001004401.1 hypothetical protein -
NB629_RS03395 (NB629_03395) 715479..715697 + 219 WP_000005879.1 hypothetical protein -
NB629_RS03400 (NB629_03400) 716194..716394 - 201 WP_001059082.1 cold-shock protein -
NB629_RS03405 (NB629_03405) 716751..717437 - 687 WP_001574556.1 thermonuclease family protein -
NB629_RS03410 (NB629_03410) 717778..718335 - 558 WP_000824491.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T247360 WP_000052076.1 NZ_CP098253:714100-714288 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT247360 WP_001059690.1 NZ_CP098253:713811-714071 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References