Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 1680378..1680991 | Replicon | chromosome |
| Accession | NZ_CP098247 | ||
| Organism | Oxalobacter aliiformigenes strain BA2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NB636_RS08080 | Protein ID | WP_269281372.1 |
| Coordinates | 1680378..1680560 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NB636_RS08085 | Protein ID | WP_269281371.1 |
| Coordinates | 1680572..1680991 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB636_RS08055 (NB636_08020) | 1676585..1678252 | - | 1668 | WP_269281376.1 | terminase large subunit | - |
| NB636_RS08060 (NB636_08025) | 1678255..1678749 | - | 495 | WP_269281375.1 | P27 family phage terminase small subunit | - |
| NB636_RS08065 (NB636_08030) | 1678709..1679527 | - | 819 | WP_269281374.1 | DNA adenine methylase | - |
| NB636_RS08070 (NB636_08035) | 1679624..1680001 | - | 378 | WP_269281373.1 | HNH endonuclease | - |
| NB636_RS08080 (NB636_08045) | 1680378..1680560 | + | 183 | WP_269281372.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NB636_RS08085 (NB636_08050) | 1680572..1680991 | + | 420 | WP_269281371.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NB636_RS08090 (NB636_08055) | 1681039..1681383 | - | 345 | WP_269281370.1 | antiterminator Q family protein | - |
| NB636_RS08095 (NB636_08060) | 1681376..1681648 | - | 273 | WP_269281369.1 | hypothetical protein | - |
| NB636_RS08100 (NB636_08065) | 1681927..1684269 | - | 2343 | WP_269281368.1 | VapE family protein | - |
| NB636_RS08105 (NB636_08070) | 1684259..1684696 | - | 438 | WP_269281367.1 | hypothetical protein | - |
| NB636_RS08110 (NB636_08075) | 1684693..1684869 | - | 177 | WP_269281366.1 | hypothetical protein | - |
| NB636_RS08115 (NB636_08080) | 1684866..1685165 | - | 300 | WP_269281365.1 | hypothetical protein | - |
| NB636_RS08120 (NB636_08085) | 1685496..1685771 | + | 276 | WP_269281364.1 | BrnT family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1651068..1692245 | 41177 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6737.88 Da Isoelectric Point: 11.1661
>T247357 WP_269281372.1 NZ_CP098247:1680378-1680560 [Oxalobacter aliiformigenes]
MKYSDFKKWLQKQGAVFTSHKSGSSHFRVSLNGKTTIFPFHGAKEIGTGLVKKIKRDLGL
MKYSDFKKWLQKQGAVFTSHKSGSSHFRVSLNGKTTIFPFHGAKEIGTGLVKKIKRDLGL
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15800.42 Da Isoelectric Point: 4.6583
>AT247357 WP_269281371.1 NZ_CP098247:1680572-1680991 [Oxalobacter aliiformigenes]
MLMYPVKLTPDDNGTVMIEIPDIPEVTSVGDDEDEALLNVREALECAIQLYFDERRPVPMPSKPQQGQAVVCLPALETSK
VLLWNEMLGQKIRKAELARRLNVYMPQIDRLFDLKHSSKIEFVERAFNAIGKQLSISVM
MLMYPVKLTPDDNGTVMIEIPDIPEVTSVGDDEDEALLNVREALECAIQLYFDERRPVPMPSKPQQGQAVVCLPALETSK
VLLWNEMLGQKIRKAELARRLNVYMPQIDRLFDLKHSSKIEFVERAFNAIGKQLSISVM
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|