Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1007786..1008362 Replicon chromosome
Accession NZ_CP098247
Organism Oxalobacter aliiformigenes strain BA2

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NB636_RS04870 Protein ID WP_269279633.1
Coordinates 1007786..1007971 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NB636_RS04875 Protein ID WP_269279631.1
Coordinates 1007976..1008362 (+) Length 129 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB636_RS04840 (NB636_04825) 1003743..1004129 - 387 WP_269279649.1 hypothetical protein -
NB636_RS04845 (NB636_04830) 1004156..1004338 - 183 WP_269279647.1 hypothetical protein -
NB636_RS04850 (NB636_04835) 1004448..1005179 - 732 WP_269279644.1 GNAT family N-acetyltransferase -
NB636_RS04855 (NB636_04840) 1005582..1006310 + 729 WP_269279642.1 dihydrofolate reductase family protein -
NB636_RS04860 1006307..1006810 - 504 WP_269279639.1 hypothetical protein -
NB636_RS04865 (NB636_04850) 1006833..1007015 + 183 WP_269279636.1 hypothetical protein -
NB636_RS04870 (NB636_04855) 1007786..1007971 + 186 WP_269279633.1 type II toxin-antitoxin system HicA family toxin Toxin
NB636_RS04875 (NB636_04860) 1007976..1008362 + 387 WP_269279631.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NB636_RS04880 (NB636_04865) 1008359..1008766 + 408 WP_269279630.1 DUF4431 domain-containing protein -
NB636_RS04885 (NB636_04870) 1009248..1009877 + 630 WP_269279627.1 hypothetical protein -
NB636_RS04890 (NB636_04875) 1009874..1010470 + 597 WP_269279625.1 DNA-3-methyladenine glycosylase I -
NB636_RS04895 (NB636_04880) 1011120..1011401 + 282 WP_269279622.1 hypothetical protein -
NB636_RS04900 (NB636_04885) 1012095..1012280 - 186 WP_269279619.1 hypothetical protein -
NB636_RS04905 (NB636_04890) 1012293..1012793 - 501 WP_269295660.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-124)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6861.03 Da        Isoelectric Point: 10.4871

>T247354 WP_269279633.1 NZ_CP098247:1007786-1007971 [Oxalobacter aliiformigenes]
MDSKEIIKQLEKAGWKLRDVNGSHHIYTHPERGGHISIPHPKKDLGVGLVKKLLKQAGLKE

Download         Length: 186 bp

Antitoxin


Download         Length: 129 a.a.        Molecular weight: 13857.64 Da        Isoelectric Point: 4.2257

>AT247354 WP_269279631.1 NZ_CP098247:1007976-1008362 [Oxalobacter aliiformigenes]
MKYPIAIEPGTDDTAFGVVVPDLPGCFSAGDTLEEAIDNAGEAAKLWLETVIDDGGIVPAASSFSVLQTKDDYKGWIWAV
IDVDLSDLSDKTERINITLPSRVLRRIDRDAKAAGESRSGFIARRMLS

Download         Length: 387 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References