Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 408696..409277 | Replicon | chromosome |
| Accession | NZ_CP098247 | ||
| Organism | Oxalobacter aliiformigenes strain BA2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NB636_RS01915 | Protein ID | WP_269280998.1 |
| Coordinates | 408696..408989 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NB636_RS01920 | Protein ID | WP_269280996.1 |
| Coordinates | 408993..409277 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB636_RS01885 (NB636_01880) | 404366..405202 | + | 837 | WP_269281008.1 | dihydropteroate synthase | - |
| NB636_RS01890 (NB636_01885) | 405226..406572 | + | 1347 | WP_269281005.1 | phosphoglucosamine mutase | - |
| NB636_RS01905 (NB636_01900) | 406912..407958 | - | 1047 | WP_269281003.1 | site-specific integrase | - |
| NB636_RS01910 (NB636_01905) | 408156..408623 | - | 468 | WP_269281001.1 | single-stranded DNA-binding protein | - |
| NB636_RS01915 (NB636_01910) | 408696..408989 | + | 294 | WP_269280998.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NB636_RS01920 (NB636_01915) | 408993..409277 | + | 285 | WP_269280996.1 | putative addiction module antidote protein | Antitoxin |
| NB636_RS01925 (NB636_01920) | 409514..410557 | - | 1044 | WP_269280993.1 | recombinase RecT | - |
| NB636_RS01930 (NB636_01925) | 410568..411470 | - | 903 | WP_269280991.1 | YqaJ viral recombinase family protein | - |
| NB636_RS01935 (NB636_01930) | 411470..411637 | - | 168 | WP_269280988.1 | hypothetical protein | - |
| NB636_RS01940 (NB636_01935) | 411707..412063 | - | 357 | WP_269280985.1 | hypothetical protein | - |
| NB636_RS01945 (NB636_01940) | 412270..412569 | + | 300 | WP_269280982.1 | ADP-ribosyl-(dinitrogen reductase) hydrolase | - |
| NB636_RS01950 (NB636_01945) | 412562..412882 | + | 321 | WP_269280979.1 | hypothetical protein | - |
| NB636_RS01955 (NB636_01950) | 413268..413918 | - | 651 | WP_269280978.1 | S24 family peptidase | - |
| NB636_RS01960 (NB636_01955) | 414018..414224 | + | 207 | WP_269280975.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 406912..455607 | 48695 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11048.75 Da Isoelectric Point: 10.0967
>T247352 WP_269280998.1 NZ_CP098247:408696-408989 [Oxalobacter aliiformigenes]
MKYFVEALDSFNDWLGSLRDIRAKVAIVRRIDRAGLGNFGDHKAVGEGVSEMRIDIGQGYRVYYTIRQQRIVFLLCGGNK
VTQSDDIKRAIKLAREV
MKYFVEALDSFNDWLGSLRDIRAKVAIVRRIDRAGLGNFGDHKAVGEGVSEMRIDIGQGYRVYYTIRQQRIVFLLCGGNK
VTQSDDIKRAIKLAREV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|