Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RHH |
| Location | 317732..318285 | Replicon | chromosome |
| Accession | NZ_CP098247 | ||
| Organism | Oxalobacter aliiformigenes strain BA2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NB636_RS01485 | Protein ID | WP_269277900.1 |
| Coordinates | 318010..318285 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NB636_RS01480 | Protein ID | WP_269277898.1 |
| Coordinates | 317732..318010 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB636_RS01455 (NB636_01450) | 313532..315514 | + | 1983 | WP_269277888.1 | acetate--CoA ligase | - |
| NB636_RS01465 (NB636_01460) | 315792..316979 | - | 1188 | WP_269277891.1 | DUF3596 domain-containing protein | - |
| NB636_RS01470 (NB636_01465) | 317139..317327 | - | 189 | WP_269277893.1 | hypothetical protein | - |
| NB636_RS01475 (NB636_01470) | 317377..317532 | - | 156 | WP_269277895.1 | hypothetical protein | - |
| NB636_RS01480 (NB636_01475) | 317732..318010 | + | 279 | WP_269277898.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NB636_RS01485 (NB636_01480) | 318010..318285 | + | 276 | WP_269277900.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NB636_RS01490 (NB636_01485) | 318363..319337 | - | 975 | WP_269277902.1 | hypothetical protein | - |
| NB636_RS01495 (NB636_01490) | 319328..319771 | - | 444 | WP_269277904.1 | hypothetical protein | - |
| NB636_RS01500 (NB636_01495) | 319814..320584 | - | 771 | WP_269277907.1 | LexA family transcriptional regulator | - |
| NB636_RS01505 (NB636_01500) | 320585..320737 | + | 153 | WP_269277910.1 | helix-turn-helix transcriptional regulator | - |
| NB636_RS01510 (NB636_01505) | 320734..320931 | + | 198 | WP_269277911.1 | hypothetical protein | - |
| NB636_RS01515 (NB636_01510) | 320964..321302 | + | 339 | WP_269277914.1 | hypothetical protein | - |
| NB636_RS01520 (NB636_01515) | 321366..321758 | + | 393 | WP_269295636.1 | hypothetical protein | - |
| NB636_RS01525 (NB636_01520) | 321755..322354 | + | 600 | WP_269281848.1 | hypothetical protein | - |
| NB636_RS01530 (NB636_01525) | 322386..322598 | - | 213 | WP_269295637.1 | hypothetical protein | - |
| NB636_RS01535 (NB636_01530) | 322603..322911 | - | 309 | WP_269281046.1 | HigA family addiction module antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10664.37 Da Isoelectric Point: 10.4490
>T247351 WP_269277900.1 NZ_CP098247:318010-318285 [Oxalobacter aliiformigenes]
MELKWTSKAASDLSRLYEFLAPANKKAAARAIQALIKAPNILLTNPRISEQLFEFESQEVRRILIGNYEIRYEIKSSTIF
VLRVWHTRENR
MELKWTSKAASDLSRLYEFLAPANKKAAARAIQALIKAPNILLTNPRISEQLFEFESQEVRRILIGNYEIRYEIKSSTIF
VLRVWHTRENR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|