Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4535623..4536455 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | KFZ69_RS21895 | Protein ID | WP_073487848.1 |
| Coordinates | 4536081..4536455 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | KFZ69_RS21890 | Protein ID | WP_001278232.1 |
| Coordinates | 4535623..4535991 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS21860 (4532459) | 4532459..4532914 | + | 456 | WP_000581504.1 | IrmA family protein | - |
| KFZ69_RS21865 (4532993) | 4532993..4533226 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| KFZ69_RS21870 (4533326) | 4533326..4534144 | + | 819 | WP_137520546.1 | DUF932 domain-containing protein | - |
| KFZ69_RS21875 (4534199) | 4534199..4534684 | + | 486 | WP_000849582.1 | antirestriction protein | - |
| KFZ69_RS21880 (4534700) | 4534700..4535176 | + | 477 | WP_001186726.1 | RadC family protein | - |
| KFZ69_RS21885 (4535239) | 4535239..4535460 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| KFZ69_RS21890 (4535623) | 4535623..4535991 | + | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| KFZ69_RS21895 (4536081) | 4536081..4536455 | + | 375 | WP_073487848.1 | TA system toxin CbtA family protein | Toxin |
| KFZ69_RS21900 (4536452) | 4536452..4536940 | + | 489 | WP_000777541.1 | DUF5983 family protein | - |
| KFZ69_RS21905 (4536952) | 4536952..4537149 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| KFZ69_RS21910 (4537246) | 4537246..4537533 | + | 288 | Protein_4289 | DUF4942 domain-containing protein | - |
| KFZ69_RS21915 (4537605) | 4537605..4538609 | + | 1005 | WP_001179707.1 | IS110-like element ISSfl8 family transposase | - |
| KFZ69_RS21920 (4538891) | 4538891..4539175 | + | 285 | Protein_4291 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4537605..4538609 | 1004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14004.02 Da Isoelectric Point: 8.7453
>T247337 WP_073487848.1 NZ_CP098234:4536081-4536455 [Escherichia coli]
MKTLPNTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPNTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT247337 WP_001278232.1 NZ_CP098234:4535623-4535991 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|