Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4353518..4354113 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | KFZ69_RS21005 | Protein ID | WP_000239579.1 |
| Coordinates | 4353518..4353868 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | KFZ69_RS21010 | Protein ID | WP_001223208.1 |
| Coordinates | 4353862..4354113 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS20985 (4348794) | 4348794..4349816 | - | 1023 | WP_001355798.1 | ABC transporter permease | - |
| KFZ69_RS20990 (4349830) | 4349830..4351332 | - | 1503 | WP_000205791.1 | sugar ABC transporter ATP-binding protein | - |
| KFZ69_RS20995 (4351642) | 4351642..4352598 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| KFZ69_RS21000 (4352908) | 4352908..4353438 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| KFZ69_RS21005 (4353518) | 4353518..4353868 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| KFZ69_RS21010 (4353862) | 4353862..4354113 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| KFZ69_RS21015 (4354325) | 4354325..4354666 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| KFZ69_RS21020 (4354669) | 4354669..4358448 | - | 3780 | WP_000060896.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T247336 WP_000239579.1 NZ_CP098234:c4353868-4353518 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |