Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4250678..4251510 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | KFZ69_RS20530 | Protein ID | WP_000854753.1 |
| Coordinates | 4250678..4251052 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | KFZ69_RS20535 | Protein ID | WP_137516139.1 |
| Coordinates | 4251142..4251510 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS20500 (4247092) | 4247092..4247985 | + | 894 | WP_032214559.1 | WYL domain-containing protein | - |
| KFZ69_RS20505 (4248183) | 4248183..4248381 | - | 199 | Protein_4013 | transposase | - |
| KFZ69_RS20510 (4248504) | 4248504..4249283 | - | 780 | Protein_4014 | integrase arm-type DNA-binding domain-containing protein | - |
| KFZ69_RS20515 (4249747) | 4249747..4249905 | - | 159 | WP_170990682.1 | hypothetical protein | - |
| KFZ69_RS20520 (4249984) | 4249984..4250181 | - | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| KFZ69_RS20525 (4250193) | 4250193..4250681 | - | 489 | WP_042038638.1 | DUF5983 family protein | - |
| KFZ69_RS20530 (4250678) | 4250678..4251052 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| KFZ69_RS20535 (4251142) | 4251142..4251510 | - | 369 | WP_137516139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KFZ69_RS20540 (4251560) | 4251560..4252204 | - | 645 | WP_040076132.1 | hypothetical protein | - |
| KFZ69_RS20545 (4252223) | 4252223..4252444 | - | 222 | WP_001556363.1 | DUF987 domain-containing protein | - |
| KFZ69_RS20550 (4252507) | 4252507..4252983 | - | 477 | WP_040076129.1 | RadC family protein | - |
| KFZ69_RS20555 (4252999) | 4252999..4253484 | - | 486 | WP_040076127.1 | antirestriction protein | - |
| KFZ69_RS20560 (4253539) | 4253539..4254357 | - | 819 | WP_040076125.1 | DUF932 domain-containing protein | - |
| KFZ69_RS20565 (4254456) | 4254456..4254617 | - | 162 | WP_225090687.1 | hypothetical protein | - |
| KFZ69_RS20570 (4255106) | 4255106..4255612 | - | 507 | WP_001556367.1 | hypothetical protein | - |
| KFZ69_RS20575 (4255646) | 4255646..4256326 | - | 681 | WP_097505405.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T247335 WP_000854753.1 NZ_CP098234:c4251052-4250678 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13616.36 Da Isoelectric Point: 6.7436
>AT247335 WP_137516139.1 NZ_CP098234:c4251510-4251142 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|