Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3756983..3757818 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | KFZ69_RS18190 | Protein ID | WP_089567659.1 |
| Coordinates | 3756983..3757360 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | KFZ69_RS18195 | Protein ID | WP_275874817.1 |
| Coordinates | 3757450..3757818 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS18165 (3752513) | 3752513..3753832 | + | 1320 | WP_000144687.1 | site-specific integrase | - |
| KFZ69_RS18170 (3753925) | 3753925..3754773 | - | 849 | WP_001280444.1 | DUF4942 domain-containing protein | - |
| KFZ69_RS18175 (3755056) | 3755056..3756075 | - | 1020 | WP_000875212.1 | IS110 family transposase | - |
| KFZ69_RS18180 (3756289) | 3756289..3756486 | - | 198 | WP_000839232.1 | DUF957 domain-containing protein | - |
| KFZ69_RS18185 (3756498) | 3756498..3756986 | - | 489 | WP_000761703.1 | DUF5983 family protein | - |
| KFZ69_RS18190 (3756983) | 3756983..3757360 | - | 378 | WP_089567659.1 | TA system toxin CbtA family protein | Toxin |
| KFZ69_RS18195 (3757450) | 3757450..3757818 | - | 369 | WP_275874817.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KFZ69_RS18200 (3757893) | 3757893..3758114 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| KFZ69_RS18205 (3758201) | 3758201..3758677 | - | 477 | WP_001186725.1 | RadC family protein | - |
| KFZ69_RS18210 (3758693) | 3758693..3759172 | - | 480 | WP_086258366.1 | antirestriction protein | - |
| KFZ69_RS18215 (3759266) | 3759266..3759511 | - | 246 | WP_000680583.1 | hypothetical protein | - |
| KFZ69_RS18220 (3759511) | 3759511..3760329 | - | 819 | WP_001234621.1 | DUF932 domain-containing protein | - |
| KFZ69_RS18225 (3760550) | 3760550..3760960 | - | 411 | WP_000846706.1 | hypothetical protein | - |
| KFZ69_RS18230 (3760976) | 3760976..3761659 | - | 684 | WP_000775504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3726025..3786941 | 60916 | |
| - | flank | IS/Tn | - | - | 3755056..3756075 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14041.96 Da Isoelectric Point: 7.3843
>T247333 WP_089567659.1 NZ_CP098234:c3757360-3756983 [Escherichia coli]
MNTLPDTHVREASHCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
MNTLPDTHVREASHCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13816.73 Da Isoelectric Point: 7.3716
>AT247333 WP_275874817.1 NZ_CP098234:c3757818-3757450 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|