Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3569845..3570463 | Replicon | chromosome |
Accession | NZ_CP098234 | ||
Organism | Escherichia coli strain ZYB39 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | KFZ69_RS17305 | Protein ID | WP_001291435.1 |
Coordinates | 3570245..3570463 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | KFZ69_RS17300 | Protein ID | WP_000344800.1 |
Coordinates | 3569845..3570219 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ69_RS17290 (3564934) | 3564934..3566127 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
KFZ69_RS17295 (3566150) | 3566150..3569299 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
KFZ69_RS17300 (3569845) | 3569845..3570219 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
KFZ69_RS17305 (3570245) | 3570245..3570463 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
KFZ69_RS17310 (3570634) | 3570634..3571185 | + | 552 | WP_000102556.1 | maltose O-acetyltransferase | - |
KFZ69_RS17315 (3571301) | 3571301..3571771 | + | 471 | WP_000136192.1 | YlaC family protein | - |
KFZ69_RS17320 (3571935) | 3571935..3573485 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
KFZ69_RS17325 (3573527) | 3573527..3573880 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
KFZ69_RS17335 (3574259) | 3574259..3574570 | + | 312 | WP_000409911.1 | MGMT family protein | - |
KFZ69_RS17340 (3574601) | 3574601..3575173 | - | 573 | WP_187225142.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247332 WP_001291435.1 NZ_CP098234:3570245-3570463 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247332 WP_000344800.1 NZ_CP098234:3569845-3570219 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |