Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1470321..1470946 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A2J1DF47 |
| Locus tag | KFZ69_RS07115 | Protein ID | WP_000911331.1 |
| Coordinates | 1470548..1470946 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | KFZ69_RS07110 | Protein ID | WP_000450524.1 |
| Coordinates | 1470321..1470548 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS07085 (1466124) | 1466124..1466594 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| KFZ69_RS07090 (1466594) | 1466594..1467166 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| KFZ69_RS07095 (1467312) | 1467312..1468190 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| KFZ69_RS07100 (1468207) | 1468207..1469241 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| KFZ69_RS07105 (1469454) | 1469454..1470167 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| KFZ69_RS07110 (1470321) | 1470321..1470548 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| KFZ69_RS07115 (1470548) | 1470548..1470946 | + | 399 | WP_000911331.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| KFZ69_RS07120 (1471093) | 1471093..1471956 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| KFZ69_RS07125 (1471971) | 1471971..1473986 | + | 2016 | WP_001543081.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| KFZ69_RS07130 (1474060) | 1474060..1474758 | + | 699 | WP_000679812.1 | esterase | - |
| KFZ69_RS07135 (1474868) | 1474868..1475068 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14862.19 Da Isoelectric Point: 9.2216
>T247324 WP_000911331.1 NZ_CP098234:1470548-1470946 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLVELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLVELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J1DF47 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |