Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 848723..849521 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | KFZ69_RS04100 | Protein ID | WP_000854899.1 |
| Coordinates | 848723..849100 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | KFZ69_RS04105 | Protein ID | WP_001442992.1 |
| Coordinates | 849147..849521 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS04065 (844006) | 844006..845184 | + | 1179 | WP_000094974.1 | type II secretion system protein GspL | - |
| KFZ69_RS04070 (845186) | 845186..845722 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| KFZ69_RS04075 (846003) | 846003..846287 | - | 285 | Protein_800 | DUF4942 domain-containing protein | - |
| KFZ69_RS04080 (846569) | 846569..847573 | - | 1005 | WP_001179707.1 | IS110-like element ISSfl8 family transposase | - |
| KFZ69_RS04085 (847645) | 847645..847932 | - | 288 | Protein_802 | DUF4942 domain-containing protein | - |
| KFZ69_RS04090 (848029) | 848029..848226 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| KFZ69_RS04095 (848238) | 848238..848726 | - | 489 | WP_000779174.1 | DUF5983 family protein | - |
| KFZ69_RS04100 (848723) | 848723..849100 | - | 378 | WP_000854899.1 | TA system toxin CbtA family protein | Toxin |
| KFZ69_RS04105 (849147) | 849147..849521 | - | 375 | WP_001442992.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KFZ69_RS04110 (849684) | 849684..849905 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| KFZ69_RS04115 (849968) | 849968..850444 | - | 477 | WP_001186770.1 | RadC family protein | - |
| KFZ69_RS04120 (850460) | 850460..850945 | - | 486 | WP_000849582.1 | antirestriction protein | - |
| KFZ69_RS04125 (851000) | 851000..851818 | - | 819 | WP_040100725.1 | DUF932 domain-containing protein | - |
| KFZ69_RS04130 (851918) | 851918..852151 | - | 234 | WP_001119724.1 | DUF905 family protein | - |
| KFZ69_RS04135 (852230) | 852230..852685 | - | 456 | WP_000581494.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 846569..847573 | 1004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14227.22 Da Isoelectric Point: 6.8438
>T247321 WP_000854899.1 NZ_CP098234:c849100-848723 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADECVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADECVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13764.50 Da Isoelectric Point: 6.6249
>AT247321 WP_001442992.1 NZ_CP098234:c849521-849147 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGQTCEADTLGSCGYVYLAVYPAQTPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGQTCEADTLGSCGYVYLAVYPAQTPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|