Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 50536..51331 | Replicon | chromosome |
| Accession | NZ_CP098234 | ||
| Organism | Escherichia coli strain ZYB39 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | KFZ69_RS00265 | Protein ID | WP_000854919.1 |
| Coordinates | 50536..50913 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | KFZ69_RS00270 | Protein ID | WP_001285623.1 |
| Coordinates | 50960..51331 (-) | Length | 124 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ69_RS00230 (45852) | 45852..47036 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| KFZ69_RS00235 (47433) | 47433..47594 | - | 162 | Protein_46 | RhuM family protein | - |
| KFZ69_RS00240 (47821) | 47821..48114 | - | 294 | Protein_47 | DUF4942 domain-containing protein | - |
| KFZ69_RS00245 (48396) | 48396..49400 | - | 1005 | WP_001179707.1 | IS110-like element ISSfl8 family transposase | - |
| KFZ69_RS00250 (49472) | 49472..50032 | - | 561 | Protein_49 | DUF4942 domain-containing protein | - |
| KFZ69_RS00255 (50117) | 50117..50314 | - | 198 | WP_085948736.1 | DUF957 domain-containing protein | - |
| KFZ69_RS00260 (50342) | 50342..50539 | - | 198 | Protein_51 | DUF5983 family protein | - |
| KFZ69_RS00265 (50536) | 50536..50913 | - | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| KFZ69_RS00270 (50960) | 50960..51331 | - | 372 | WP_001285623.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KFZ69_RS00275 (51409) | 51409..51630 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| KFZ69_RS00280 (51693) | 51693..52169 | - | 477 | WP_001186770.1 | RadC family protein | - |
| KFZ69_RS00285 (52185) | 52185..52670 | - | 486 | WP_275874765.1 | antirestriction protein | - |
| KFZ69_RS00290 (52762) | 52762..53580 | - | 819 | WP_001175146.1 | DUF932 domain-containing protein | - |
| KFZ69_RS00295 (53670) | 53670..53903 | - | 234 | WP_001278378.1 | DUF905 family protein | - |
| KFZ69_RS00300 (53909) | 53909..54586 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| KFZ69_RS00305 (54734) | 54734..55414 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| KFZ69_RS00310 (55526) | 55526..55951 | + | 426 | WP_000422741.1 | transposase | - |
| KFZ69_RS00315 (55948) | 55948..56298 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 48396..49400 | 1004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T247318 WP_000854919.1 NZ_CP098234:c50913-50536 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|