Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 31805..32330 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP098233 | ||
| Organism | Escherichia coli strain XJ34 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | KFZ60_RS24630 | Protein ID | WP_001159871.1 |
| Coordinates | 32025..32330 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q3ZU16 |
| Locus tag | KFZ60_RS24625 | Protein ID | WP_000813639.1 |
| Coordinates | 31805..32023 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ60_RS24610 (27083) | 27083..27187 | - | 105 | WP_001443026.1 | IS3 family transposase | - |
| KFZ60_RS24615 (27215) | 27215..28051 | - | 837 | WP_000222506.1 | helix-turn-helix domain-containing protein | - |
| KFZ60_RS24620 (28734) | 28734..29699 | - | 966 | Protein_22 | IS3 family transposase | - |
| KFZ60_RS24625 (31805) | 31805..32023 | + | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| KFZ60_RS24630 (32025) | 32025..32330 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| KFZ60_RS24635 (32331) | 32331..33138 | + | 808 | Protein_25 | site-specific integrase | - |
| KFZ60_RS24640 (33837) | 33837..34592 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| KFZ60_RS24645 (35180) | 35180..36346 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| KFZ60_RS24650 (36346) | 36346..37317 | + | 972 | WP_000817031.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..72766 | 72766 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T247313 WP_001159871.1 NZ_CP098233:32025-32330 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9DIR5 |