Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4174876..4175690 | Replicon | chromosome |
| Accession | NZ_CP098231 | ||
| Organism | Escherichia coli strain XJ34 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | KFZ60_RS20125 | Protein ID | WP_001054376.1 |
| Coordinates | 4174876..4175133 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | - |
| Locus tag | KFZ60_RS20130 | Protein ID | WP_088375732.1 |
| Coordinates | 4175145..4175690 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ60_RS20100 (4170164) | 4170164..4171270 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| KFZ60_RS20105 (4171335) | 4171335..4172315 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| KFZ60_RS20110 (4172425) | 4172425..4172630 | + | 206 | Protein_3936 | HNH endonuclease | - |
| KFZ60_RS20115 (4172898) | 4172898..4174138 | - | 1241 | Protein_3937 | helicase YjhR | - |
| KFZ60_RS20120 (4174254) | 4174254..4174385 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| KFZ60_RS20125 (4174876) | 4174876..4175133 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| KFZ60_RS20130 (4175145) | 4175145..4175690 | + | 546 | WP_088375732.1 | N-acetyltransferase | Antitoxin |
| KFZ60_RS20135 (4175746) | 4175746..4176492 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| KFZ60_RS20140 (4176661) | 4176661..4176879 | + | 219 | Protein_3942 | hypothetical protein | - |
| KFZ60_RS20145 (4176917) | 4176917..4177033 | + | 117 | Protein_3943 | VOC family protein | - |
| KFZ60_RS20150 (4177278) | 4177278..4178399 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| KFZ60_RS20155 (4178396) | 4178396..4178674 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| KFZ60_RS20160 (4178686) | 4178686..4179999 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4164662..4183914 | 19252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T247310 WP_001054376.1 NZ_CP098231:4174876-4175133 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT247310 WP_088375732.1 NZ_CP098231:4175145-4175690 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRAAFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRAAFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|