Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4006656..4007206 Replicon chromosome
Accession NZ_CP098231
Organism Escherichia coli strain XJ34

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag KFZ60_RS19340 Protein ID WP_001160974.1
Coordinates 4006656..4006970 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag KFZ60_RS19345 Protein ID WP_000125566.1
Coordinates 4006973..4007206 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFZ60_RS19315 (4002331) 4002331..4003617 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
KFZ60_RS19320 (4003617) 4003617..4004606 + 990 WP_075331727.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
KFZ60_RS19325 (4004603) 4004603..4005424 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
KFZ60_RS19330 (4005427) 4005427..4005804 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
KFZ60_RS19335 (4005811) 4005811..4006659 + 849 WP_000257188.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
KFZ60_RS19340 (4006656) 4006656..4006970 - 315 WP_001160974.1 CcdB family protein Toxin
KFZ60_RS19345 (4006973) 4006973..4007206 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
KFZ60_RS19350 (4007292) 4007292..4007771 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
KFZ60_RS19355 (4007963) 4007963..4009825 - 1863 WP_097755997.1 glutathione-regulated potassium-efflux system protein KefC -
KFZ60_RS19360 (4009818) 4009818..4010348 - 531 WP_000600718.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
KFZ60_RS19365 (4010459) 4010459..4011790 - 1332 WP_001183198.1 MFS transporter -
KFZ60_RS19370 (4011849) 4011849..4012136 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T247308 WP_001160974.1 NZ_CP098231:c4006970-4006656 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT247308 WP_000125566.1 NZ_CP098231:c4007206-4006973 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References