Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3547735..3548353 | Replicon | chromosome |
Accession | NZ_CP098231 | ||
Organism | Escherichia coli strain XJ34 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | KFZ60_RS17150 | Protein ID | WP_001291435.1 |
Coordinates | 3548135..3548353 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | KFZ60_RS17145 | Protein ID | WP_000344800.1 |
Coordinates | 3547735..3548109 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ60_RS17135 (3542824) | 3542824..3544017 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
KFZ60_RS17140 (3544040) | 3544040..3547189 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
KFZ60_RS17145 (3547735) | 3547735..3548109 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
KFZ60_RS17150 (3548135) | 3548135..3548353 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
KFZ60_RS17155 (3548525) | 3548525..3549076 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
KFZ60_RS17160 (3549192) | 3549192..3549662 | + | 471 | WP_000136192.1 | YlaC family protein | - |
KFZ60_RS17165 (3549826) | 3549826..3551376 | + | 1551 | WP_021577088.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
KFZ60_RS17170 (3551418) | 3551418..3551771 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
KFZ60_RS17175 (3552115) | 3552115..3552342 | - | 228 | WP_024183738.1 | DUF2188 domain-containing protein | - |
KFZ60_RS17180 (3552560) | 3552560..3553180 | - | 621 | WP_001267012.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247304 WP_001291435.1 NZ_CP098231:3548135-3548353 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247304 WP_000344800.1 NZ_CP098231:3547735-3548109 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |