Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3135799..3136504 | Replicon | chromosome |
Accession | NZ_CP098231 | ||
Organism | Escherichia coli strain XJ34 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A246P0D5 |
Locus tag | KFZ60_RS15230 | Protein ID | WP_000539522.1 |
Coordinates | 3135799..3136185 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | KFZ60_RS15235 | Protein ID | WP_001280945.1 |
Coordinates | 3136175..3136504 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ60_RS15210 (3131803) | 3131803..3132429 | + | 627 | WP_032280600.1 | glutathione S-transferase GstB | - |
KFZ60_RS15215 (3132426) | 3132426..3133541 | - | 1116 | WP_032280599.1 | aldose sugar dehydrogenase YliI | - |
KFZ60_RS15220 (3133652) | 3133652..3134035 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
KFZ60_RS15225 (3134248) | 3134248..3135573 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
KFZ60_RS15230 (3135799) | 3135799..3136185 | + | 387 | WP_000539522.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KFZ60_RS15235 (3136175) | 3136175..3136504 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
KFZ60_RS15240 (3136574) | 3136574..3137902 | - | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
KFZ60_RS15245 (3137910) | 3137910..3140258 | - | 2349 | WP_028132100.1 | EAL domain-containing protein | - |
KFZ60_RS15250 (3140436) | 3140436..3141347 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14292.51 Da Isoelectric Point: 10.2120
>T247303 WP_000539522.1 NZ_CP098231:3135799-3136185 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIKDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIKDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|