Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2449182..2449820 | Replicon | chromosome |
| Accession | NZ_CP098231 | ||
| Organism | Escherichia coli strain XJ34 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | KFZ60_RS11845 | Protein ID | WP_000813794.1 |
| Coordinates | 2449644..2449820 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | KFZ60_RS11840 | Protein ID | WP_001270286.1 |
| Coordinates | 2449182..2449598 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ60_RS11820 (2444334) | 2444334..2445275 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| KFZ60_RS11825 (2445276) | 2445276..2446289 | - | 1014 | WP_086217925.1 | ABC transporter ATP-binding protein | - |
| KFZ60_RS11830 (2446307) | 2446307..2447452 | - | 1146 | WP_088376267.1 | ABC transporter substrate-binding protein | - |
| KFZ60_RS11835 (2447697) | 2447697..2449103 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| KFZ60_RS11840 (2449182) | 2449182..2449598 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| KFZ60_RS11845 (2449644) | 2449644..2449820 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| KFZ60_RS11850 (2450042) | 2450042..2450272 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| KFZ60_RS11855 (2450364) | 2450364..2452325 | - | 1962 | WP_021577429.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| KFZ60_RS11860 (2452398) | 2452398..2452934 | - | 537 | WP_021577428.1 | DNA-binding transcriptional regulator SutR | - |
| KFZ60_RS11865 (2452987) | 2452987..2454201 | + | 1215 | WP_089534812.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2454241..2455389 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T247302 WP_000813794.1 NZ_CP098231:c2449820-2449644 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT247302 WP_001270286.1 NZ_CP098231:c2449598-2449182 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|