Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4264964..4265559 | Replicon | chromosome |
| Accession | NZ_CP098229 | ||
| Organism | Escherichia coli strain XJ55 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | KFZ57_RS20885 | Protein ID | WP_000239579.1 |
| Coordinates | 4264964..4265314 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | KFZ57_RS20890 | Protein ID | WP_001223208.1 |
| Coordinates | 4265308..4265559 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ57_RS20865 (4260240) | 4260240..4261262 | - | 1023 | WP_001317446.1 | ABC transporter permease | - |
| KFZ57_RS20870 (4261276) | 4261276..4262778 | - | 1503 | WP_000205793.1 | sugar ABC transporter ATP-binding protein | - |
| KFZ57_RS20875 (4263088) | 4263088..4264044 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| KFZ57_RS20880 (4264354) | 4264354..4264884 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| KFZ57_RS20885 (4264964) | 4264964..4265314 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| KFZ57_RS20890 (4265308) | 4265308..4265559 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| KFZ57_RS20895 (4265772) | 4265772..4266113 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| KFZ57_RS20900 (4266116) | 4266116..4269895 | - | 3780 | WP_000060901.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T247287 WP_000239579.1 NZ_CP098229:c4265314-4264964 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |