Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3610407..3611244 | Replicon | chromosome |
Accession | NZ_CP098229 | ||
Organism | Escherichia coli strain XJ55 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | KFZ57_RS17715 | Protein ID | WP_000227784.1 |
Coordinates | 3610702..3611244 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | KFZ57_RS17710 | Protein ID | WP_001297137.1 |
Coordinates | 3610407..3610718 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ57_RS17685 (3605427) | 3605427..3606374 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
KFZ57_RS17690 (3606396) | 3606396..3608387 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
KFZ57_RS17695 (3608377) | 3608377..3608991 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
KFZ57_RS17700 (3608991) | 3608991..3609320 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
KFZ57_RS17705 (3609332) | 3609332..3610222 | + | 891 | WP_000971336.1 | heme o synthase | - |
KFZ57_RS17710 (3610407) | 3610407..3610718 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
KFZ57_RS17715 (3610702) | 3610702..3611244 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
KFZ57_RS17720 (3611300) | 3611300..3612235 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
KFZ57_RS17725 (3612643) | 3612643..3614007 | + | 1365 | WP_001000978.1 | MFS transporter | - |
KFZ57_RS17730 (3614135) | 3614135..3614626 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
KFZ57_RS17735 (3614794) | 3614794..3615705 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T247284 WP_000227784.1 NZ_CP098229:3610702-3611244 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|