Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3576330..3576948 | Replicon | chromosome |
| Accession | NZ_CP098229 | ||
| Organism | Escherichia coli strain XJ55 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | KFZ57_RS17545 | Protein ID | WP_001291435.1 |
| Coordinates | 3576730..3576948 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | KFZ57_RS17540 | Protein ID | WP_000344800.1 |
| Coordinates | 3576330..3576704 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ57_RS17530 (3571419) | 3571419..3572612 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| KFZ57_RS17535 (3572635) | 3572635..3575784 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| KFZ57_RS17540 (3576330) | 3576330..3576704 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| KFZ57_RS17545 (3576730) | 3576730..3576948 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| KFZ57_RS17550 (3577120) | 3577120..3577671 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| KFZ57_RS17555 (3577787) | 3577787..3578257 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| KFZ57_RS17560 (3578421) | 3578421..3579971 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| KFZ57_RS17565 (3580013) | 3580013..3580366 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| KFZ57_RS17575 (3580745) | 3580745..3581056 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| KFZ57_RS17580 (3581087) | 3581087..3581659 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247283 WP_001291435.1 NZ_CP098229:3576730-3576948 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247283 WP_000344800.1 NZ_CP098229:3576330-3576704 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |