Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2510885..2511523 | Replicon | chromosome |
| Accession | NZ_CP098229 | ||
| Organism | Escherichia coli strain XJ55 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | KFZ57_RS12300 | Protein ID | WP_000813794.1 |
| Coordinates | 2511347..2511523 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | KFZ57_RS12295 | Protein ID | WP_001270286.1 |
| Coordinates | 2510885..2511301 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ57_RS12275 (2506037) | 2506037..2506978 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| KFZ57_RS12280 (2506979) | 2506979..2507992 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| KFZ57_RS12285 (2508010) | 2508010..2509155 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| KFZ57_RS12290 (2509400) | 2509400..2510806 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| KFZ57_RS12295 (2510885) | 2510885..2511301 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| KFZ57_RS12300 (2511347) | 2511347..2511523 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| KFZ57_RS12305 (2511745) | 2511745..2511975 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| KFZ57_RS12310 (2512067) | 2512067..2514028 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| KFZ57_RS12315 (2514101) | 2514101..2514637 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| KFZ57_RS12320 (2514729) | 2514729..2515904 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2515944..2517209 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T247281 WP_000813794.1 NZ_CP098229:c2511523-2511347 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT247281 WP_001270286.1 NZ_CP098229:c2511301-2510885 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|