Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1382602..1383227 | Replicon | chromosome |
Accession | NZ_CP098229 | ||
Organism | Escherichia coli strain XJ55 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | KFZ57_RS06715 | Protein ID | WP_000911330.1 |
Coordinates | 1382829..1383227 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | KFZ57_RS06710 | Protein ID | WP_000450524.1 |
Coordinates | 1382602..1382829 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ57_RS06685 (1378405) | 1378405..1378875 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
KFZ57_RS06690 (1378875) | 1378875..1379447 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
KFZ57_RS06695 (1379593) | 1379593..1380471 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
KFZ57_RS06700 (1380488) | 1380488..1381522 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
KFZ57_RS06705 (1381735) | 1381735..1382448 | + | 714 | WP_024186347.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
KFZ57_RS06710 (1382602) | 1382602..1382829 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
KFZ57_RS06715 (1382829) | 1382829..1383227 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
KFZ57_RS06720 (1383374) | 1383374..1384237 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
KFZ57_RS06725 (1384252) | 1384252..1386267 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
KFZ57_RS06730 (1386341) | 1386341..1387039 | + | 699 | WP_000679823.1 | esterase | - |
KFZ57_RS06735 (1387149) | 1387149..1387349 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T247273 WP_000911330.1 NZ_CP098229:1382829-1383227 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|