Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 825854..826686 | Replicon | chromosome |
| Accession | NZ_CP098229 | ||
| Organism | Escherichia coli strain XJ55 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3P5UBZ5 |
| Locus tag | KFZ57_RS03955 | Protein ID | WP_001094454.1 |
| Coordinates | 825854..826228 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3G8RJV8 |
| Locus tag | KFZ57_RS03960 | Protein ID | WP_001320394.1 |
| Coordinates | 826318..826686 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFZ57_RS03925 (820968) | 820968..822116 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| KFZ57_RS03930 (822188) | 822188..823171 | - | 984 | WP_001598619.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| KFZ57_RS03935 (823982) | 823982..824152 | - | 171 | Protein_772 | IS110 family transposase | - |
| KFZ57_RS03940 (824494) | 824494..825063 | - | 570 | WP_001290250.1 | DUF4942 domain-containing protein | - |
| KFZ57_RS03945 (825160) | 825160..825357 | - | 198 | WP_000839276.1 | DUF957 domain-containing protein | - |
| KFZ57_RS03950 (825369) | 825369..825857 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| KFZ57_RS03955 (825854) | 825854..826228 | - | 375 | WP_001094454.1 | TA system toxin CbtA family protein | Toxin |
| KFZ57_RS03960 (826318) | 826318..826686 | - | 369 | WP_001320394.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KFZ57_RS03965 (826736) | 826736..827379 | - | 644 | Protein_778 | antitoxin of toxin-antitoxin stability system | - |
| KFZ57_RS03970 (827398) | 827398..827619 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| KFZ57_RS03975 (827682) | 827682..828158 | - | 477 | WP_001347688.1 | RadC family protein | - |
| KFZ57_RS03980 (828174) | 828174..828659 | - | 486 | WP_029701480.1 | antirestriction protein | - |
| KFZ57_RS03985 (828714) | 828714..829532 | - | 819 | WP_001234642.1 | DUF932 domain-containing protein | - |
| KFZ57_RS03990 (829632) | 829632..829865 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| KFZ57_RS03995 (829944) | 829944..830399 | - | 456 | WP_000581493.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 823982..824086 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14059.10 Da Isoelectric Point: 9.2447
>T247270 WP_001094454.1 NZ_CP098229:c826228-825854 [Escherichia coli]
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13623.22 Da Isoelectric Point: 6.4783
>AT247270 WP_001320394.1 NZ_CP098229:c826686-826318 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3P5UBZ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G8RJV8 |