Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 825854..826686 Replicon chromosome
Accession NZ_CP098229
Organism Escherichia coli strain XJ55

Toxin (Protein)


Gene name yeeV Uniprot ID A0A3P5UBZ5
Locus tag KFZ57_RS03955 Protein ID WP_001094454.1
Coordinates 825854..826228 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3G8RJV8
Locus tag KFZ57_RS03960 Protein ID WP_001320394.1
Coordinates 826318..826686 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFZ57_RS03925 (820968) 820968..822116 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
KFZ57_RS03930 (822188) 822188..823171 - 984 WP_001598619.1 KpsF/GutQ family sugar-phosphate isomerase -
KFZ57_RS03935 (823982) 823982..824152 - 171 Protein_772 IS110 family transposase -
KFZ57_RS03940 (824494) 824494..825063 - 570 WP_001290250.1 DUF4942 domain-containing protein -
KFZ57_RS03945 (825160) 825160..825357 - 198 WP_000839276.1 DUF957 domain-containing protein -
KFZ57_RS03950 (825369) 825369..825857 - 489 WP_000777545.1 DUF5983 family protein -
KFZ57_RS03955 (825854) 825854..826228 - 375 WP_001094454.1 TA system toxin CbtA family protein Toxin
KFZ57_RS03960 (826318) 826318..826686 - 369 WP_001320394.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
KFZ57_RS03965 (826736) 826736..827379 - 644 Protein_778 antitoxin of toxin-antitoxin stability system -
KFZ57_RS03970 (827398) 827398..827619 - 222 WP_000692300.1 DUF987 domain-containing protein -
KFZ57_RS03975 (827682) 827682..828158 - 477 WP_001347688.1 RadC family protein -
KFZ57_RS03980 (828174) 828174..828659 - 486 WP_029701480.1 antirestriction protein -
KFZ57_RS03985 (828714) 828714..829532 - 819 WP_001234642.1 DUF932 domain-containing protein -
KFZ57_RS03990 (829632) 829632..829865 - 234 WP_001119719.1 DUF905 family protein -
KFZ57_RS03995 (829944) 829944..830399 - 456 WP_000581493.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 823982..824086 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14059.10 Da        Isoelectric Point: 9.2447

>T247270 WP_001094454.1 NZ_CP098229:c826228-825854 [Escherichia coli]
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13623.22 Da        Isoelectric Point: 6.4783

>AT247270 WP_001320394.1 NZ_CP098229:c826686-826318 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3P5UBZ5

Antitoxin

Source ID Structure
AlphaFold DB A0A3G8RJV8

References