Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4006671..4007221 Replicon chromosome
Accession NZ_CP098227
Organism Escherichia coli strain XJ6-3

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag KFZ54_RS19330 Protein ID WP_001160974.1
Coordinates 4006671..4006985 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag KFZ54_RS19335 Protein ID WP_000125566.1
Coordinates 4006988..4007221 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFZ54_RS19305 (4002346) 4002346..4003632 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
KFZ54_RS19310 (4003632) 4003632..4004621 + 990 WP_075331727.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
KFZ54_RS19315 (4004618) 4004618..4005439 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
KFZ54_RS19320 (4005442) 4005442..4005819 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
KFZ54_RS19325 (4005826) 4005826..4006674 + 849 WP_000257188.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
KFZ54_RS19330 (4006671) 4006671..4006985 - 315 WP_001160974.1 CcdB family protein Toxin
KFZ54_RS19335 (4006988) 4006988..4007221 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
KFZ54_RS19340 (4007307) 4007307..4007786 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
KFZ54_RS19345 (4007978) 4007978..4009840 - 1863 WP_097755997.1 glutathione-regulated potassium-efflux system protein KefC -
KFZ54_RS19350 (4009833) 4009833..4010363 - 531 WP_000600718.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
KFZ54_RS19355 (4010474) 4010474..4011805 - 1332 WP_001183198.1 MFS transporter -
KFZ54_RS19360 (4011864) 4011864..4012151 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T247262 WP_001160974.1 NZ_CP098227:c4006985-4006671 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT247262 WP_000125566.1 NZ_CP098227:c4007221-4006988 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References