Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3592412..3593249 | Replicon | chromosome |
Accession | NZ_CP098227 | ||
Organism | Escherichia coli strain XJ6-3 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A080JA52 |
Locus tag | KFZ54_RS17365 | Protein ID | WP_032170811.1 |
Coordinates | 3592707..3593249 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A0A080JFU1 |
Locus tag | KFZ54_RS17360 | Protein ID | WP_001577859.1 |
Coordinates | 3592412..3592723 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ54_RS17335 (3587432) | 3587432..3588379 | + | 948 | WP_001239436.1 | cytochrome o ubiquinol oxidase subunit II | - |
KFZ54_RS17340 (3588401) | 3588401..3590392 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
KFZ54_RS17345 (3590382) | 3590382..3590996 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
KFZ54_RS17350 (3590996) | 3590996..3591325 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
KFZ54_RS17355 (3591337) | 3591337..3592227 | + | 891 | WP_000971336.1 | heme o synthase | - |
KFZ54_RS17360 (3592412) | 3592412..3592723 | + | 312 | WP_001577859.1 | DUF1778 domain-containing protein | Antitoxin |
KFZ54_RS17365 (3592707) | 3592707..3593249 | + | 543 | WP_032170811.1 | GNAT family N-acetyltransferase | Toxin |
KFZ54_RS17370 (3593305) | 3593305..3594240 | - | 936 | WP_045176456.1 | tetratricopeptide repeat protein | - |
KFZ54_RS17375 (3594647) | 3594647..3596011 | + | 1365 | WP_001000956.1 | MFS transporter | - |
KFZ54_RS17380 (3596139) | 3596139..3596630 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
KFZ54_RS17385 (3596798) | 3596798..3597709 | + | 912 | WP_088375888.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | espY3 / espY3 | 3592412..3605830 | 13418 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19835.05 Da Isoelectric Point: 8.3395
>T247259 WP_032170811.1 NZ_CP098227:3592707-3593249 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRTSLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRTSLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A080JA52 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A080JFU1 |