Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3547750..3548368 | Replicon | chromosome |
Accession | NZ_CP098227 | ||
Organism | Escherichia coli strain XJ6-3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | KFZ54_RS17140 | Protein ID | WP_001291435.1 |
Coordinates | 3548150..3548368 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | KFZ54_RS17135 | Protein ID | WP_000344800.1 |
Coordinates | 3547750..3548124 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ54_RS17125 (3542839) | 3542839..3544032 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
KFZ54_RS17130 (3544055) | 3544055..3547204 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
KFZ54_RS17135 (3547750) | 3547750..3548124 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
KFZ54_RS17140 (3548150) | 3548150..3548368 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
KFZ54_RS17145 (3548540) | 3548540..3549091 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
KFZ54_RS17150 (3549207) | 3549207..3549677 | + | 471 | WP_000136192.1 | YlaC family protein | - |
KFZ54_RS17155 (3549841) | 3549841..3551391 | + | 1551 | WP_021577088.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
KFZ54_RS17160 (3551433) | 3551433..3551786 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
KFZ54_RS17165 (3552130) | 3552130..3552357 | - | 228 | WP_024183738.1 | DUF2188 domain-containing protein | - |
KFZ54_RS17170 (3552575) | 3552575..3553195 | - | 621 | WP_001267012.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247258 WP_001291435.1 NZ_CP098227:3548150-3548368 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247258 WP_000344800.1 NZ_CP098227:3547750-3548124 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |