Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3135814..3136519 | Replicon | chromosome |
Accession | NZ_CP098227 | ||
Organism | Escherichia coli strain XJ6-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A246P0D5 |
Locus tag | KFZ54_RS15220 | Protein ID | WP_000539522.1 |
Coordinates | 3135814..3136200 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | KFZ54_RS15225 | Protein ID | WP_001280945.1 |
Coordinates | 3136190..3136519 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ54_RS15200 (3131818) | 3131818..3132444 | + | 627 | WP_032280600.1 | glutathione S-transferase GstB | - |
KFZ54_RS15205 (3132441) | 3132441..3133556 | - | 1116 | WP_032280599.1 | aldose sugar dehydrogenase YliI | - |
KFZ54_RS15210 (3133667) | 3133667..3134050 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
KFZ54_RS15215 (3134263) | 3134263..3135588 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
KFZ54_RS15220 (3135814) | 3135814..3136200 | + | 387 | WP_000539522.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KFZ54_RS15225 (3136190) | 3136190..3136519 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
KFZ54_RS15230 (3136589) | 3136589..3137917 | - | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
KFZ54_RS15235 (3137925) | 3137925..3140273 | - | 2349 | WP_028132100.1 | EAL domain-containing protein | - |
KFZ54_RS15240 (3140451) | 3140451..3141362 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14292.51 Da Isoelectric Point: 10.2120
>T247257 WP_000539522.1 NZ_CP098227:3135814-3136200 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIKDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIKDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|